PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g08040.1
Common NameLR48_Vigan02g197600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 569aa    MW: 64052.2 Da    PI: 4.5163
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g08040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.6e-53291552128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     +pGfrFhPtdeelv++yLk+k+ gk+l+l +vi+e+d+yk++P++Lp +  +k+++++w+fF++rd+ky++g r+nrat++gyWkatgkd++v++
  Vang06g08040.1  29 MPGFRFHPTDEELVMYYLKRKICGKRLKL-NVIRETDVYKWDPEELPgQsILKTGDRQWFFFCHRDRKYPNGARSNRATRHGYWKATGKDRNVIC 122
                     69***************************.99**************96446788999************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kktLvfy grap+g++tdWvmhey++
  Vang06g08040.1 123 -NSRAVGVKKTLVFYIGRAPSGTRTDWVMHEYTM 155
                     .999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-6024178IPR003441NAC domain
PROSITE profilePS5100554.07528178IPR003441NAC domain
PfamPF023651.7E-2730154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
LFGFCSRSRM GEASGDGSAD CFSQMMSSMP GFRFHPTDEE LVMYYLKRKI CGKRLKLNVI  60
RETDVYKWDP EELPGQSILK TGDRQWFFFC HRDRKYPNGA RSNRATRHGY WKATGKDRNV  120
ICNSRAVGVK KTLVFYIGRA PSGTRTDWVM HEYTMDEEEL KRCQGVKDYY ALYKVFKKSG  180
PGPKNGEQYG APFNEQEWAA DDDIVDFNNN ITDQEDPNVV PENGSALHPL LDDEINDIIR  240
EILDDELVLD QQHVNGYLDF PQVVTEETQS TVVDQFSEVL MYRETTDPSC QYFDVQPSFD  300
FNQPVTSHLQ VSEASEVSSA SNIQRKGLDL DKVGFLEIND LIDNDPALAN VENPVEYPHF  360
EDGLSELDLY QDAEMFLRDL GPIIHETDSH AYTNALVSNN IESQSYQLQS GSEDANQTVG  420
EFWMHDERNT LIPSEEGFVD SFSLSSPGVV CESLSFPTEG NYNQSSTVED VSTSSFSSSL  480
WAFVESIPTT PASAAESALV NRALNRMSSF SRVKIRHTNI TAGKDTATTK KAGRKGFSFL  540
FFPILIALCA FLWVFVGNLR SLGRCISP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-493015517140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14655KRKICGKRLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6573050.0KF657305.1 Glycine max NAC transcription factor (SNAC38) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014514171.10.0PREDICTED: NAC domain-containing protein 17-like
TrEMBLA0A0L9TZ880.0A0A0L9TZ88_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SNG30.0A0A0S3SNG3_PHAAN; Uncharacterized protein
STRINGGLYMA10G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-120NAC domain containing protein 17
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]